PACAP (1-27), human, ovine, rat
PACAP (1-27) (人、羊、大鼠)
Also known as: PACAP 1-27, PACAP-27 (human, ovine, rat), Pituitary adenylate cyclase-activating polypeptide 1-27 (human, ovine, rat), HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2, MFCD00167418, PACAP (1-27), human, ovine, rat (TFA)
PACAP (1-27), human, ovine, rat (CAS 127317-03-7) is a compound in the Organic Compounds category listed in the Jingsj chemical database. It has the molecular formula C142H224N40O39S and a molecular weight of 3147.608 g/mol. It is also known as PACAP 1-27, PACAP-27 (human, ovine, rat) and Pituitary adenylate cyclase-activating polypeptide 1-27 (human, ovine, rat). Key property: a density of 1.5±0.1 g/cm3. No supplier offers are currently listed; request a quote. Record last updated Aug 21, 2026.
- CAS No.
- 127317-03-7
- Jingsj CID
- J-30960-8
- Molecular Formula
- C142H224N40O39S
- Chinese Name
- PACAP (1-27) (人、羊、大鼠)
- Molecular Weight
- 3147.608 g/mol
- Category
- Organic Compounds
- Last updated
- 8/21/2026
No offers for this compound yet.
Request a quotePhysicochemical Properties
| Density | 1.5±0.1 g/cm3 |
|---|
Frequently Asked Questions
What is the CAS number of PACAP (1-27), human, ovine, rat?
The CAS number of PACAP (1-27), human, ovine, rat is 127317-03-7.
What are the molecular formula and molecular weight of PACAP (1-27), human, ovine, rat?
PACAP (1-27), human, ovine, rat has molecular formula C142H224N40O39S and molecular weight 3147.608 g/mol.
Data compiled from public chemical databases and supplier catalogs; supplier offers are provided by suppliers.
Last updated:
How to cite: Jingsj. "PACAP (1-27), human, ovine, rat (CAS 127317-03-7)". Jingsj Chemical Database. https://www.jingsj.com/compound/J-30960-8 (accessed 2026-10-24).
Data for reference only; verify specifications, grades and regulatory status with suppliers before purchase.