Galanin, human

Also known as: Galanin (1-30) (human), Galanin human, Galanin-1-30, GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS, GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-VAL-GLY-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-ASN-GLY-LEU-THR-SER, H-GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-VAL-GLY-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-ASN-GLY-LEU-THR-SER-OH

Galanin, human (CAS 119418-04-1) is a compound in the Pharma Intermediates category listed in the Jingsj chemical database. It has the molecular formula C139H210N42O43 and a molecular weight of 3157.41000 g/mol. No supplier offers are currently listed; request a quote. Record last updated Aug 21, 2026.

CAS No.: 119418-04-1
Jingsj CID: J-1959002-6
Molecular Formula: C₁₃₉H₂₁₀N₄₂O₄₃
Molecular Weight: 3157.41000 g/mol
Category: Pharma Intermediates
Last updated: 8/21/2026

Request MSDS / TDS

No offers for this compound yet.

Request a quote

Physicochemical Properties

Exact Mass	3155.55000
PSA	1367.68000

Activity & Biological Data

Target	Kd: 1 nM (GalR1 receptor), 1 nM (GalR2 receptor)[2]
Additional Information	[1]. Hua XY, et al. Galanin acts at GalR1 receptors in spinal antinociception: synergy with morphine and AP-5. J Pharmacol Exp Ther. 2004 Feb;308(2):574-82. [2]. Schmidt WE, et al. Isolation and primary structure of pituitary human galanin, a 30-residue nonamidated neuropeptide. Proc Natl Acad Sci U S A. 1991 Dec 15;88(24):11435-9.

Frequently Asked Questions

What is the CAS number of Galanin, human?

The CAS number of Galanin, human is 119418-04-1.

What are the molecular formula and molecular weight of Galanin, human?

Galanin, human has molecular formula C139H210N42O43 and molecular weight 3157.41000 g/mol.

Data compiled from public chemical databases such as PubChem and supplier catalogs; supplier offers are provided by suppliers.

Last updated: 8/21/2026

How to cite: Jingsj. "Galanin, human (CAS 119418-04-1)". Jingsj Chemical Database. https://www.jingsj.com/compound/J-1959002-6 (accessed 2026-11-07).

Data for reference only; verify product details with suppliers before purchase.