Peptide YY (human)

多肽YY(人)

Also known as: Human peptide YY, PYY (human), Peptide YY, human, Peptide tyrosine tyrosine, human, MFCD00081843, YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2

Peptide YY (human) (CAS 118997-30-1) is a compound in the Pharma Intermediates category listed in the Jingsj chemical database. It has the molecular formula C194H295N55O57 and a molecular weight of 4309.81 g/mol. It is also known as Human peptide YY, PYY (human) and Peptide YY, human. No supplier offers are currently listed; request a quote. Record last updated Aug 21, 2026.

CAS No.: 118997-30-1
Jingsj CID: J-50293-9
Molecular Formula: C₁₉₄H₂₉₅N₅₅O₅₇
Chinese Name: 多肽YY(人)
Molecular Weight: 4309.81 g/mol
Category: Pharma Intermediates
Last updated: 8/21/2026

No offers for this compound yet.

Request a quote

Frequently Asked Questions

What is the CAS number of Peptide YY (human)?

The CAS number of Peptide YY (human) is 118997-30-1.

What are the molecular formula and molecular weight of Peptide YY (human)?

Peptide YY (human) has molecular formula C194H295N55O57 and molecular weight 4309.81 g/mol.

Data compiled from public chemical databases and supplier catalogs; supplier offers are provided by suppliers.

Last updated: 8/21/2026

How to cite: Jingsj. "Peptide YY (human) (CAS 118997-30-1)". Jingsj Chemical Database. https://www.jingsj.com/compound/J-50293-9 (accessed 2026-10-23).

Data for reference only; verify specifications, grades and regulatory status with suppliers before purchase.