Peptide YY (3-36), human

人多肽 YY (3-36)

Also known as: Peptide YY (3-36) (human) trifluoroacetate salt, Human peptide YY (3-36), 3-36-Human peptide YY, PYY (3-36) (human), H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2, IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2

Peptide YY (3-36), human (CAS 123583-37-9) is a compound in the Pharma Intermediates category listed in the Jingsj chemical database. It has the molecular formula C180H279N53O54 and a molecular weight of 4049.46 g/mol. It is also known as Peptide YY (3-36) (human) trifluoroacetate salt, Human peptide YY (3-36) and 3-36-Human peptide YY. No supplier offers are currently listed; request a quote. Record last updated Aug 21, 2026.

CAS No.: 123583-37-9
Jingsj CID: J-1987897-9
Molecular Formula: C₁₈₀H₂₇₉N₅₃O₅₄
Chinese Name: 人多肽 YY (3-36)
Molecular Weight: 4049.46 g/mol
Category: Pharma Intermediates
Last updated: 8/21/2026

No offers for this compound yet.

Request a quote

Frequently Asked Questions

What is the CAS number of Peptide YY (3-36), human?

The CAS number of Peptide YY (3-36), human is 123583-37-9.

What are the molecular formula and molecular weight of Peptide YY (3-36), human?

Peptide YY (3-36), human has molecular formula C180H279N53O54 and molecular weight 4049.46 g/mol.

Data compiled from public chemical databases and supplier catalogs; supplier offers are provided by suppliers.

Last updated: 8/21/2026

How to cite: Jingsj. "Peptide YY (3-36), human (CAS 123583-37-9)". Jingsj Chemical Database. https://www.jingsj.com/compound/J-1987897-9 (accessed 2026-10-24).

Data for reference only; verify specifications, grades and regulatory status with suppliers before purchase.